• Cykla i Filmlandskapet SmålandCykla i Filmlandskapet Småland

  • Cykla i Filmlandskapet SmålandCykla i Filmlandskapet Småland

  • Cykla i Filmlandskapet SmålandCykla i Filmlandskapet Småland

Cykla i Filmlandskapet Småland

Typ

  • Familjeaktivitet

  • Sevärdhet och landmärke

  • Idrottsaktivitet

  • Kulturaktivitet

  • Provning

  • Natur och park

  • Friluftsaktivitet

  • Rundtur

Beskrivning

Guidade cykelturer

Cykla i Filmlandskapet Småland i Mariannelund erbjuder guidade cykelturer till Bullerbyn, Katthult och Mariannelund i Astrid Lindgrens barndomslandskap. Följ med på cykeltur i behagligt tempo till de klassiska inspelningsplatserna från filmerna om Emil i Lönneberga och Barnen i Bullerbyn. Ta del av berättelserna från filminspelningarna som engagerade en hel bygd. En natur- och kulturupplevelse som förstärks av lokalt mathantverk i cykelkorgen och handvävd trasmatta på pakethållaren. Öppna turer tisdagar och torsdagar i juli och augusti. Bokas på vår hemsida. För minst 8 personer finns möjlighet att boka en egen tur.

Självguidade turer
Du kan också cykla på egen hand i Filmlandskapet med våra självguidade turer. Välj någon av våra sex turer, alla startar och slutar vid filmmuseet Filmbyn Småland i Mariannelund och går bland annat till Bullerby, Katthult och filminspelningsplatserna i Mariannelund. Längs turerna, som är mellan 12-65 kilometer långa, passerar du förutom inspelningsplatser en rad unika naturfenomen och sevärdheter. Du cyklar på mindre trafikerade asfalts- och grusvägar genom sagolik småländsk natur med röda stugor, gärdsgårdar, stenmurar, levande bondgårdar, odlingslandskap, glittrande sjöar och stora skogar.
Vi cyklar på klassiska cyklar tillverkade i Småland, med sju växlar, fotbroms och korg. I upplevelsen ingår cykelhjälm, karta, vägbeskrivning och en handvävd småländsk trasmatta att sitta eller ligga på vid fikastopp och pauser. Elcyklar och cyklar med barnsadel, barnvagn, hänga-på-cykel samt juniorcyklar. Du har tillgång till cykeln hela dagen.

I korgcykling är det nämligen inte den som kommer först mål som vinner – utan den som har upplevt mest längs vägen.

Det ska vara enkelt, roligt och hållbart att uppleva Småland!

Konferens

Söker du en utomhusaktivitet där alla kan delta? Vad sägs som en stillsam tur på stabila småländska cyklar/elcyklar med 7 växlar och fotbroms? En natur- och kulturupplevelse kryddad med lokala smaker! Boka en guidad cykeltur för gruppen, och följ med till de klassiska inspelningsplatserna! Vår certifirade naturguide och lokalguide berättar anekdoterna från tiden på 1970-talet då Mariannelund blev en filmby och hela bygden blev engagerad i inspelningarna av Emilfilmerna.
Tidsåtgång 2,5-3 timmar. Start och mål vid Filmbyn Småland i Mariannelund.

Vi har ett nära samarbete med boende- och konferensanläggningar.

Kontakta oss på info@cyklaifilmlandskapetsmaland.se

Kontakt

Paketerbjudande

Guidade turer, fasta turer sommaren 2023:

Bullerbyn & Katthult – en heldag på elcykel med guide
25 km, 5 timmar inkl. lunchmacka och provsmakning av lokalt mathantverk.
Körs tisdagar juli och augusti
Pris 1595 SEK/person
Boka på vår hemsida

Småländska kultur- och smakupplevelser
Guidad tur till inspelningsplatserna där filmerna om Emil i Lönneberga spelades in.
17 km, 4 timmar, inkl. lunchmacka och provsmakning av lokalt mathantverk.
Körs torsdagar juli och augusti
Pris: 925 SEK/person
Bokas på vår hemsida.

Båda turerna går att boka för grupper (minst 8 personer) under perioden april-oktober.
Kontakta Carina & Carina på info@cyklaifilmlandskapetsmaland.se

Tips

För tips på boende, besöksmål, café- och matställen i närområdet, se vår hemsida.

Upptäck andra företag